PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI06G07920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 322aa    MW: 36168.1 Da    PI: 6.2811
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI06G07920.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l  +++++G  +W+  ++  g++R++k+c++rw +yl
  ORUFI06G07920.1 14 KGPWTPEEDEKLMSYIQKHGHASWRVLPELAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.13.6e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++ eE++ +++++  lG++ W++Ia++++ gRt++++k++w+++
  ORUFI06G07920.1  67 RGNFSREEEQTILQLHSILGNK-WSAIAKHLP-GRTDNEIKNFWNTH 111
                      89********************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-25564IPR009057Homeodomain-like
PROSITE profilePS5129416.93961IPR017930Myb domain
SuperFamilySSF466892.25E-3111108IPR009057Homeodomain-like
SMARTSM007171.0E-131363IPR001005SANT/Myb domain
PfamPF002492.1E-161461IPR001005SANT/Myb domain
CDDcd001672.82E-101661No hitNo description
PROSITE profilePS5129425.60662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2665117IPR009057Homeodomain-like
SMARTSM007171.0E-1666114IPR001005SANT/Myb domain
PfamPF002495.5E-1667111IPR001005SANT/Myb domain
CDDcd001672.03E-1269111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGRPPCCDEN GLKKGPWTPE EDEKLMSYIQ KHGHASWRVL PELAGLNRCG KSCRLRWTNY  60
LKPDIKRGNF SREEEQTILQ LHSILGNKWS AIAKHLPGRT DNEIKNFWNT HHRKKLIKMG  120
IDPMTHCPRT DFFQSLPQLI ALANLRQIIE RQPWDGHMEG LQTVAVQAAK LEYMQSLLHS  180
AVSIVTSPTT TTTTSSLNTF TTELEQTNHL CPPQVPSSSV PELAVQVPHS QMPSTSFDQE  240
IGKTNLFSNN IVNGNEWCSM EADNSSQKSL LVPENSIPPL IDMPVQNFCN TISTPNCDGG  300
NSIPLPSWSE ILLDEELMGE FA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C4e-30121162105C-Myb DNA-Binding Domain
1msf_C4e-30121162105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00180DAPTransfer from AT1G34670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0047270.0AP004727.2 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0516A04.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644332.10.0PREDICTED: myb-related protein 330
SwissprotQ8GWP08e-70MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0E0PV740.0A0A0E0PV74_ORYRU; Uncharacterized protein
STRINGLOC_Os06g11780.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112637132
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-97myb domain protein 93